PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT29146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 150aa    MW: 16761.5 Da    PI: 8.2237
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT29146genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY894e-2862120159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vk +v  +++dp +v++tYeg+H h 
  EMT29146  62 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCSVKERVGGDRDDPAYVVTTYEGTHSHV 120
               59*******************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-3048122IPR003657WRKY domain
SuperFamilySSF1182901.24E-2554122IPR003657WRKY domain
PROSITE profilePS5081128.58757122IPR003657WRKY domain
SMARTSM007745.7E-2962121IPR003657WRKY domain
PfamPF031063.4E-2263119IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MGQMFANPSG HIHGQPVEWR PSNDILHFKT VDNELLAESA AAAERPRTER IAFRTRTEIE  60
ILDDGYKWRK YGKKSVKNSP NPRNYYRCST EGCSVKERVG GDRDDPAYVV TTYEGTHSHV  120
SPSTVYYASQ DAASGRFFVA GTHPPPGSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A8e-2350122274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8274020.0KR827402.1 Triticum aestivum WRKY51 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654710.12e-66PREDICTED: probable WRKY transcription factor 26
SwissprotQ93WU96e-38WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLM8CZ471e-111M8CZ47_AEGTA; Uncharacterized protein
STRINGMLOC_10264.21e-70(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-36WRKY DNA-binding protein 51